PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV29721.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family STAT
Protein Properties Length: 1136aa    MW: 127612 Da    PI: 7.1124
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV29721.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT187.81.3e-583324531122
        STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfrikfeipklkkypfle 99 
                 ld+vll+a+g +v+k++evvasLlyad+g++ve+++d e+pLLisydG+ef+s drp+kl++GrasfklkisqLsskc+nrLfri+f+ipk+ +y+fle
  KZV29721.1 332 LDIVLLDAFGCSVNKELEVVASLLYADNGALVENTNDGEPPLLISYDGIEFASPDRPCKLINGRASFKLKISQLSSKCENRLFRIRFDIPKFGRYHFLE 430
                 89************************************************************************************************* PP

        STAT 100 avskpirCisrsrntrsssltkk 122
                 a++ pirC+sr rnt ++sl++k
  KZV29721.1 431 ALTLPIRCVSRYRNTPTASLSWK 453
                 ****************9999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF513164.29E-34177IPR011057Mss4-like
Gene3DG3DSA:2.170.150.201.6E-33177IPR002579Peptide methionine sulphoxide reductase MrsB
PfamPF016412.0E-31177IPR002579Peptide methionine sulphoxide reductase MrsB
TIGRFAMsTIGR003576.5E-34177IPR002579Peptide methionine sulphoxide reductase MrsB
Gene3DG3DSA:3.30.505.101.3E-4718780IPR000980SH2 domain
PROSITE profilePS500019.856719808IPR000980SH2 domain
SuperFamilySSF555506.91E-7719796IPR000980SH2 domain
Gene3DG3DSA:3.30.200.201.5E-18850938No hitNo description
SuperFamilySSF561127.93E-768551133IPR011009Protein kinase-like domain
SMARTSM002208.0E-308621136IPR000719Protein kinase domain
PROSITE profilePS5001140.3588621136IPR000719Protein kinase domain
PfamPF000696.5E-488641130IPR000719Protein kinase domain
PROSITE patternPS001070868890IPR017441Protein kinase, ATP binding site
Gene3DG3DSA:1.10.510.107.9E-459391133No hitNo description
PROSITE patternPS001080984996IPR008271Serine/threonine-protein kinase, active site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006468Biological Processprotein phosphorylation
GO:0055114Biological Processoxidation-reduction process
GO:0004672Molecular Functionprotein kinase activity
GO:0005524Molecular FunctionATP binding
GO:0033743Molecular Functionpeptide-methionine (R)-S-oxide reductase activity
Sequence ? help Back to Top
Protein Sequence    Length: 1136 aa     Download sequence    Send to blast
YHCICCDTPL FESSTKFDSG TGWPSYYQPI GNNVKSKLDL SIIFMPRQEV ICAACDAHLG  60
HVFDDGPPPT GKRYCINRGG NSDGSGGFES GWGSVVIKRS LGKMKGGEGL GEQNYVLLKD  120
LKVEFSTDEY MEDGNGRCII CFWVYINVCT CFPSVILEQK SQNLTSGWPF LCLDEKKKLT  180
FFPLLFLHQG GLDPANSVPS KGVPCAASEA EFSLKRWVHV GCEMLHDFVR LHIDGEIVGE  240
KFLKCESNKG LLADALRGMY LSCPNGNEDS FNGYVYGMDV SFQASDIKGR FLKNSPLRLS  300
IDHSVPSEIE EDSDGVWSIV GGKASCRRIF SLDIVLLDAF GCSVNKELEV VASLLYADNG  360
ALVENTNDGE PPLLISYDGI EFASPDRPCK LINGRASFKL KISQLSSKCE NRLFRIRFDI  420
PKFGRYHFLE ALTLPIRCVS RYRNTPTASL SWKKASSNKT YSNGCESSDL DDGSAELIPT  480
IIRQAKPSPS SKRIKLGHDK PFAAKEEYFP VKQSSKDIDS HASITNEDNA YDVSMSMRPE  540
NHNRARQNSS ASESSEATNS DPNNISFSDS VVFKYCLGGP ADRCELLKEI ASSASEDHLL  600
YLADQVSLYS GCFHHRPQIV MAKRLLEEGR QAWTSISRNN DHVLWETLIL RINYYFMKIS  660
RSTRCLTDQD LECLRRIAGC QDFVSLENFE RMWYWLYPVA FNLSKKMLTA MWDSLSPLWI  720
AGLISKEDAE FTLQCQGGLQ DPGTFVLRFP TSRSWPHPDA GNLVVSYVGS DHTIHHRLLS  780
LDYMHRASLN MVNKKMLPLY ITIGVVAFVI SKIIMAILCY RRWKRKQMVF QDSFTGGKLV  840
MFRSPRTNSL EPKLFLKKTM KLSNKDVIGS GGYGTVYKLM INESISFAVK RLNRLNAEHD  900
RGFERELEAM GDIKHRNIVT LHGYYAAPQY NLLIYELMPN GSLDTLLHGK SMNKMILDWP  960
SRYRIAVGAA RGISYLHHDC IPHIIHRDIK SSNILLDHNL EARVSDFGLA TLMEPDKTHV  1020
STFVAGTFGY LAPEYFDTGK ATAKGDVYSY GVVLLELLTG KKPTDESFIE EGTKLVTWVK  1080
TVVQDKREEC VLDSILEGCP AKEINHVFGI ALMCLEPEPT KRPTMAEVVK MLEQIM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4oh4_A8e-76840113516319Protein BRASSINOSTEROID INSENSITIVE 1
4oh4_B8e-76840113516319Protein BRASSINOSTEROID INSENSITIVE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011082815.10.0PREDICTED: uncharacterized protein LOC105165486
TrEMBLA0A022RDB30.0A0A022RDB3_ERYGU; Uncharacterized protein
STRINGSolyc07g062050.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA93942325
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78540.11e-160SH2 domain protein B